1. Introduction
This manual documents the BLAST (Basic Local Alignment Search Tool) command line applications developed at the National Center for Biotechnology Information (NCBI). These applications have been revamped to provide an improved user interface, new features, and performance improvements compared to its counterparts in the NCBI C Toolkit. Hereafter we shall distinguish the C Toolkit BLAST command line applications from these command line applications by referring to the latter as the BLAST+ applications, which have been developed using the NCBI C++ Toolkit (http://www.ncbi.nlm.nih.gov/books/NBK7160/).
Please feel free to contact us with any questions, feedback, or bug reports at blast-help@ncbi.nlm.nih.gov.
2. Installation
The BLAST+ applications are distributed in executable and source code format. For the executable formats we provide installers as well as tarballs; the source code is only provided as a tarball. These are freely available atftp://ftp.ncbi.nlm.nih.gov/blast/executables/blast+/. Please be sure to use the most recent available version; this will be indicated in the file name (for instance, in the sections below, version 2.2.18 is listed, but this should be replaced accordingly).
2.1 Windows
Download the executable installer ncbi-blast-2.2.18+.exe and double click on it. After accepting the license agreement, select the install location and click “Install” and then “Close”
2.2 MacOSX
For users without administrator privileges: Download the ncbi-blast-2.2.18+-universal-macosx.tar.gz tarball and follow the procedure described in Other Unix platforms.
For users with administrator privileges and machines MacOSX version 10.5 or higher: Download the ncbi-blast-2.2.18+.dmg installer and double click on it. Double click the newly mounted ncbi-blast-2.2.18+ volume, double click on ncbi-blast-2.2.18+.pkg and follow the instructions in the installer. By default the BLAST+ applications are installed in /usr/local/ncbi/blast, overwriting its previous contents (an uninstaller is provided and it is recommended when upgrading a BLAST+ installation).
2.3 RedHat Linux
Download the appropriate *.rpm file for your platform and either install or upgrade the ncbi-blast+ package as appropriate using the commands:
Install: rpm -ivh ncbi-blast-2.2.18-1.x86_64.rpm Upgrade: rpm -Uvh ncbi-blast-2.2.18-1.x86_64.rpm
Note: one must have root privileges to run these commands. If you do not have root privileges, please use the procedure described inOther Unix platforms.
2.4 Other Unix platforms
Download the tarball and expand it in the location of your choice.
2.5 Source tarball
Use this approach if you would like to build the BLAST+ applications yourself. Download the tarball, expand it and in the expanded directory type the following commands:
cd c++ ./configure --without-debug --with-strip --with-mt --with-build-root=ReleaseMT cd ReleaseMT/build make all_r
The compiled executables will be found in c++/ReleaseMT/bin.
In Windows, extract the tarball and open the appropriate MSVC solution or project file (e.g.: c++\compilers\msvc800_prj\static\build), build the -CONFIGURE- project, click on “Reload” when prompted by the development environment, and then build the -BUILD-ALL- project. The compiled executables will be found in the directory corresponding to the build configuration selected (e.g.: c++\compilers\msvc800_prj\static\bin\debugdll).
3. Quick start
3.1 For users of NCBI C Toolkit BLAST
The easiest way to get started using these command line applications is by means of the legacy_blast.pl PERL script which is bundled along with the BLAST+ applications. To utilize this script, simply prefix it to the invocation of the C toolkit BLAST command line application and append the --path option pointing to the installation directory of the BLAST+ applications. For example, instead of using
blastall -i query -d nr -o blast.out
use
legacy_blast.pl blastall -i query -d nr -o blast.out --path /opt/blast/bin
For more details, refer to the section titled Backwards compatibility script.
3.2 For users of Web BLAST (http://blast.ncbi.nlm.nih.gov)
Users of Web BLAST can take advantage of the search strategies to quickly get started using the BLAST+ applications, as these intend to allow seamless integration between the Web and command line BLAST tools. For more details, refer to the section onBLAST search strategies.
3.3 For new users of BLAST
An introduction to BLAST is outside the scope of this manual, more information on this subject can be found onhttp://blast.ncbi.nlm.nih.gov/Blast.cgi?CMD=Web&PAGE_TYPE=BlastDocs. Nonetheless, new users will benefit from the examples in the cookbook as well as reading the user manual.
3.4 Downloading BLAST databases
The BLAST databases are required to run BLAST locally and to support automatic resolution of sequence identifiers. Documentation about these can be found ftp://ftp.ncbi.nlm.nih.gov/blast/db/README. These databases may be retrieved automatically with the update_blastdb.pl perl script, which is included as part of this distribution.
This script will download multiple tar files for each BLAST database volume if necessary, without having to designate each volume. For example:
./update_blastdb.pl htgs
will download all the relevant HTGs tar files (htgs.00.tar.gz, …, htgs.N.tar.gz)
The script can also compare your local copy of the database tar file(s) and only download tar files if the date stamp has changed reflecting a newer version of the database. This will allow the script run on a schedule and only download tar files when needed. Documentation for the update_blastdb.pl script can be obtained by running the script without any arguments (perl is required).
4. User manual
4.1 Functionality offered by BLAST+ applications
The functionality offered by the BLAST+ applications has been organized by program type, as to more closely resemble Web BLAST. The following graph depicts a correspondence between the NCBI C Toolkit BLAST command line applications and the BLAST+ applications:

As an example, to run a search of a nucleotide query (translated “on the fly” by BLAST) against a protein database one would use the blastx application instead of blastall. The blastx application will also work in “Blast2Sequences” mode (i.e.: accept FASTAsequences instead of a BLAST database as targets) and can also send BLAST searches over the network to the public NCBI server if desired.
The blastn, blastp, blastx, tblastx, tblastn, psiblast, rpsblast, and rpstblastn are considered search applications, as they execute aBLAST search, whereas makeblastdb, blastdb_aliastool, and blastdbcmd are considered BLAST database applications, as they either create or examine BLAST databases.
There is also a new set of sequence filtering applications described in the section Sequence filtering applications and an application to build database indices that greatly speed up megablast in some cases (see section titled Megablast indexed searches).
Please note that the NCBI C Toolkit applications seedtop and blastclust are not available in this release.
4.2 Common options
The following is a listing of options that are common to the majority of BLAST+ applications followed by a brief description of what they do:
4.2.1 best_hit_overhang: Overhang value for Best-Hit algorithm. For more details, see the section Best-Hits filtering algorithm.
4.2.2 best_hit_score_edge: Score edge value for Best-Hit algorithm. For more details, see the section Best-Hits filtering algorithm.
4.2.3 db: File name of BLAST database to search the query against. Unless an absolute path is used, the database will be searched relative to the current working directory first, then relative to the value specified by the BLASTDB environment variable, then relative to the BLASTDB configuration value specified in the configuration file. Multiple databases may be provided as an argument, and they must be separated by a space. Many operating systems now allow spaces in file names and paths, so it is necessary to use quotes. See section 5.15 for details.
4.2.4 dbsize: Effective length of the database.
4.2.5 dbtype: Molecule type stored or to store in a BLAST database.
4.2.6 db_soft_mask: Filtering algorithm ID to apply to the database as soft masking for subject sequences. The algorithm IDs for a given BLAST database can be obtained by invoking blastdbcmd with its -info flag (only shown if such filtering in the BLAST database is available). For more details see the section Masking in BLAST databases.
4.2.7 culling_limit: Ensures that more than the specified number of HSPs are not aligned to the same part of the query. This option was designed for searches with a lot of repetitive matches, but if possible it is probably more efficient to mask the query to remove the repetitive sequences.
4.2.8 entrez_query: Restrict the search of the BLAST database to the results of the Entrez query provided.
4.2.9 evalue: Expectation value threshold for saving hits.
4.2.10 export_search_strategy: Name of the file where to save the search strategy (see section titled BLAST search strategies).
4.2.11 gapextend: Cost to extend a gap.
4.2.12 gapopen: Cost to open a gap.
4.2.13 gilist: File containing a list of GIs to restrict the BLAST database to search. The expect values in the BLAST results are based upon the sequences actually searched and not on the underlying database.
4.2.14 h: Displays the application’s brief documentation.
4.2.15 help: Displays the application’s detailed documentation.
4.2.16 html: Enables the generation of HTML output suitable for viewing in a web browser.
4.2.17 import_search_strategy: Name of the file where to read the search strategy to execute (see section titled BLAST search strategies).
4.2.18 lcase_masking: Interpret lowercase letters in query sequence(s) as masked.
4.2.19 matrix: Name of the scoring matrix to use.
4.2.720 max_target_seqs: Maximum number of aligned sequences to keep from the BLAST database. This option should only be used with formats that do not have a separate descriptions and alignments section, such as XML, tabular, ASN.1 or BLAST archive.
4.2.21 negative_gilist: File containing a list of GIs to exclude from the BLAST database.
4.2.22 num_alignments: Number of alignments to show in the BLAST output. This option should only be used with formats that have a separate alignments section, such as the standard BLAST report, including pairwise and any query-anchored flavor. This option may not work as expected with formats such as XML, tabular, etc. that do not have a separate alignment section. The max_target_seqs option should be used in that case
4.2.23 num_descriptions: Number of one-line descriptions to show in the BLAST output. This option should be used with output formats that have a separate descriptions section, such as the standard BLAST report, including pairwise and any query-anchored flavor. This option may not work as expected with formats such as XML, tabular, etc. that do not have a separate descriptions section. The max_target_seqs option should be used in that case.
4.2.24 num_threads: Number of threads to use during the search.
4.2.25 out: Name of the file to write the application’s output. Defaults to stdout.
4.2.26 outfmt: Allows for the specification of the search application’s output format. A listing of the possible format types is available via the search application’s -help option. If a custom output format is desired, this can be specified by providing a quoted string composed of the desired output format (tabular, tabular with comments, or comma-separated value), a space, and a space delimited list of output specifiers. The list of supported output specifiers is available via the -help command line option. Unsupported output specifiers will be ignored. This should be specified using double quotes if there are spaces in the output format specification (e.g.: -outfmt "7 sseqid ssac qstart qend sstart send qseq evalue bitscore").
4.2.27 parse_deflines: Parse the query and subject deflines.
4.2.28 query: Name of the file containing the query sequence(s), or ‘-‘ if these are provided on standard input.
4.2.29 query_loc: Location of the first query sequence to search in 1-based offsets (Format: start-stop).
4.2.30 remote: Instructs the application to submit the search to NCBI for remote execution.
4.2.31 searchsp: Effective length of the search space.
4.2.32 seg: Arguments to SEG filtering algorithm (use ‘no’ to disable).
4.2.33 show_gis: Show NCBI GIs in deflines in the BLAST output.
4.2.34 soft_masking: Apply filtering locations as soft masks (i.e.: only when finding alignment seeds).
4.2.35 subject: Name of the file containing the subject sequence(s) to search.
4.2.36 subject_loc: Location of the first subject sequence to search in 1-based offsets (Format: start-stop).
4.2.37 strand: Strand(s) of the query sequence to search.
4.2.38 threshold: Minimum word score such that the word is added to the BLAST lookup table.
4.2.39 ungapped: Perform ungapped alignments only.
4.2.40 version: Displays the application’s version.
4.2.41 window_size: Size of the window for multiple hits algorithm, use 0 to specify 1-hit algorithm.
4.2.42 word_size: Word size for word finder algorithm.
4.2.43 xdrop_gap: X-dropoff value (in bits) for preliminary gapped extensions.
4.2.44 xdrop_gap_final: X-dropoff value (in bits) for final gapped alignment.
4.2.45 xdrop_ungap: X-dropoff value (in bits) for ungapped extensions.
4.3 Backwards compatibility script
The purpose of the legacy_blast.pl Perl script is to help users make the transition from the C Toolkit BLAST command line applications to the BLAST+ applications. This script produces its own documentation by invoking it without any arguments.
The legacy_blast.pl script supports two modes of operation, one in which the C Toolkit BLAST command line invocation is converted and executed on behalf of the user and another which solely displays the BLAST+ application equivalent to what was provided, without executing the command.
The first mode of operation is achieved by specifying the C Toolkit BLAST command line application invocation and optionally providing the --path argument after the command line to convert if the installation path for the BLAST+ applications differs from the default (available by invoking the script without arguments). See example in the first section of the Quick start.
The second mode of operation is achieved by specifying the C Toolkit BLAST command line application invocation and appending the --print_only command line option as follows:
$ ./legacy_blast.pl megablast -i query.fsa -d nt -o mb.out --print_only /opt/ncbi/blast/bin/blastn -query query.fsa -db "nt" -out mb.out $
4.4 Exit codes
All BLAST+ applications have consistent exit codes to signify the exit status of the application. The possible exit codes along with their meaning are detailed in the table below:
In the case of BLAST+ database applications, the possible exit codes are 0 (indicating success) and 1 (indicating failure).
4.5 Improvements over C Toolkit BLAST command line applications
4.5.1 Query splitting
This new feature in the BLAST+ applications provides substantial performance improvements, particularly for blastx searches and it is automatically enabled by the software when deemed appropriate. Below is a graph comparing the runtime of blastall and blastx when searching different size excerpts of NC_007113 (varying from 10 kbases to about 10 Mbases) against the human genome database (experiments performed in July 2008):

4.5.2 Tasks
The concept of tasks has been added to support the notion of commonly performed tasks via the -task command line option in blastn and blastp. These tasks resemble the “Program Selection” section of the BLAST web pages and do not preclude the user from setting other options to override those specified by the task. The following tasks are currently available:
| Program | Task Name | Description |
| blastp | blastp | Traditional BLASTP to compare a protein query to a protein database |
| blastp-short | BLASTP optimized for queries shorter than 30 residues | |
| blastn | blastn | Traditional BLASTN requiring an exact match of 11 |
| blastn-short | BLASTN program optimized for sequences shorter than 50 bases | |
| megablast | Traditional megablast used to find very similar (e.g., intraspecies or closely related species) sequences | |
| dc-megablast | Discontiguous megablast used to find more distant (e.g., interspecies) sequences |
4.5.3 Megablast indexed searches
Indexed searches for megablast are available and are faster than regular megablast. The application to generate the database indices is called makembindex, which is included in this distribution. More information about it can be found atftp://ftp.ncbi.nlm.nih.gov/pub/agarwala/indexed_megablast/README.usage.
4.5.4 Partial sequence retrieval from BLAST databases
Improvements to the BLAST database reading module allow it to fetch only the relevant portions of the subject sequence that are needed in the gapped alignment stage, providing a substantial improvement in runtime. The following example compares 103 mouse EST sequences against the human genome shows (example run in July 2008 after the database had already been loaded into memory):
$ time megablast -d 9606_genomic -i est.500.in -r 2 -q -3 -F mL -m 9 -o old.out -W 11 -t 18 -G 5 -E 2 341.455u 65.242s 6:47.99 99.6% 0+0k 0+0io 0pf+0w $ time blastn -task dc-megablast -db 9606_genomic -query est.500.in -outfmt 7 -out new.out 218.540u 11.632s 3:50.53 99.8% 0+0k 0+0io 0pf+0w
Similar gains in performance should be expected in BLAST databases which contain very large sequences and many very short queries.
4.5.5 BLAST search strategies
BLAST search strategies are files which encode the inputs necessary to perform a BLAST search. The purpose of these files is to be able to seamlessly reproduce a BLAST search in various environments (Web BLAST, command line applications, etc).
4.5.5.1 Exporting search strategies on the Web BLAST
Click on "download" next to the RID/saved strategy in the "Recent Results" or "Saved Strategies" tabs.
4.5.5.2 Exporting search strategies with BLAST+ applications
Add the -export_search_strategy along with a file name to the command line options.
4.5.5.3 Importing search strategies on Web BLAST
Go to the "Saved Strategies" tab, click on "Browse" to select your search strategy file, then click on "View" to load it into the submission page.
4.5.5.4 Importing search strategies with BLAST+ applications
Add the -import_search_strategy along with a file name containing the search strategy file. Note that if provided, the –query, -db, -use_index, and –index_name command line options will override the specifications of the search strategy file provided (no other command line options will override the contents of the search strategy file).
4.5.6 Negative GI lists
Negative GI lists are available on search applications and they provide a means to exclude GIs from a BLAST database search. The expect values in the BLAST results are based upon the sequences actually searched and not on the underlying database. For an example, see the cookbook.
4.5.7 Masking in BLAST databases
It is now possible to create BLAST databases which contain filtered sequences (also known as masking information or masks). Thisfiltering information can be used as soft masking for the subject sequences. For instructions on creating masked BLAST databases, please see the cookbook.
4.5.8 Custom output formats for BLAST searches
The BLAST+ search command line applications support custom output formats for the tabular and comma-separated value output formats. For more details see the common options as well as the cookbook.
4.5.9 Custom output formats to extract BLAST database data
blastdbcmd supports custom output formats to extract data from BLAST databases via the -outfmt command line option. For more details see the blastdbcmd options as well as the cookbook.
4.5.10 Improved software installation packages
The BLAST+ applications are available via Windows and MacOSX installers as well as RPMs (source and binary) and unix tarballs. For more details about these, refer to the installation section.
4.5.11 Sequence filtering applications
The BLAST+ applications include a new set of sequence filtering applications, namely segmasker, dustmasker, and windowmasker. segmasker is an application that identifies and masks low complexity regions of protein sequences. The dustmasker and windowmasker applications provide similar functionality for nucleotide sequences (seeftp://ftp.ncbi.nlm.nih.gov/pub/agarwala/dustmasker/README.dustmasker andftp://ftp.ncbi.nlm.nih.gov/pub/agarwala/windowmasker/README.windowmasker for more information).
4.5.12 Best-Hits filtering algorithm
The Best-Hit filtering algorithm is designed for use in applications that are searching for only the best matches for each query region reporting matches. Its -best_hit_overhang parameter, H, controls when an HSP is considered short enough to be filtered due to presence of another HSP. For each HSP A that is filtered, there exists another HSP B such that the query region of HSP A extends each end of the query region of HSP B by at most H times the length of the query region for B.
Additional requirements that must also be met in order to filter A on account of B are:
-
i.
-
evalue(A) >= evalue(B)
ii.
-
score(A)/length(A) < (1.0 – score_edge) * score(B)/length(B)
We consider 0.1 to 0.25 to be an acceptable range for the -best_hit_overhang parameter and 0.05 to 0.25 to be an acceptable range for the -best_hit_score_edge parameter. Increasing the value of the overhang parameter eliminates a higher number of matches, but increases the running time; increasing the score_edge parameter removes smaller number of hits.
4.5.13 Automatic resolution of sequence identifiers
The BLAST+ search applications support automatic resolution of query and subject sequence identifiers specified as GIs or accessions (see the cookbook section for an example). This feature enables the user to specify one or more sequence identifiers (GIs and/or accessions, one per line) in a file as the input to the -query and -subject command line options.
Upon encountering this type of input, by default the BLAST+ search applications will try to resolve these sequence identifiers in locally available BLAST databases first, then in the BLAST databases at NCBI, and finally in Genbank (the latter two data sources require a properly configured internet connection). These data sources can be configured via the DATA_LOADERS configuration option and the BLAST databases to search can be configured via the BLASTDB_PROT_DATA_LOADER and BLASTDB_NUCL_DATA_LOADER configuration options (see the section on Configuring BLAST).
4.5.14 BLAST-WindowMasker integration in BLAST+ search applications
The BLAST+ search applications support integration with the windowmasker files via the -window_masker_taxid and the WINDOW_MASKER_PATH configuration parameter (see Configuring BLAST) or via the -window_masker_db command line option.
In the first case, the WINDOW_MASKER_PATH configuration parameter should refer to a directory which contains subdirectories named after NCBI taxonomy IDs (e.g.: 9606 for human, 10090 for mouse), where the windowmasker unit counts data files should be placed with the following naming convention: wmasker.obinary (for files generated with the obinary format) and/or wmasker.oascii (for files generated with the oascii format). For an example on how to create these files, please see the Cookbook. Once these windowmasker files and the configuration file are in place, this feature can be invoked by providing the taxonomy ID to the -window_masker_taxid command line option.
Alternatively, this feature can also be invoked by providing the path to the windowmasker unit counts data file via the -window_masker_db.
Please see the Cookbook for a usage example of this feature.
4.5.15 DELTA-BLAST: A tool for sensitive protein sequence search
DELTA-BLAST uses RPS-BLAST to search for conserved domains matching to a query, constructs a PSSM from the matching domains, and searches a sequence database. Its sensitivity is comparable to PSI-BLAST and does not require several iterations of searches against a large sequence database.
4.6 Options by program type
4.6.1 blastp
4.6.1.1 task: Specify the task to execute. For more details, refer to the section on tasks.
4.6.1.2 comp_based_stats: Select the appropriate composition based statistics mode (applicable only to blastp and tblastn). Available choices and references are available by invoking the application with -help option.
4.6.1.3 use_sw_tback: Instead of using the X-dropoff gapped alignment algorithm, use Smith-Waterman to compute locally optimal alignments
4.6.2 blastn
4.6.2.1 task: Specify the task to execute. For more details, refer to the section on tasks.
4.6.2.2 penalty: Penalty for a nucleotide mismatch.
4.6.2.3 reward: Reward for a nucleotide match.
4.6.2.4 use_index: Use a megablast database index.
4.6.2.5 index_name: Name of the megablast database index.
4.6.2.6 perc_identity: Minimum percent identity of matches to report
4.6.2.7 dust: Arguments to DUST filtering algorithm (use ‘no’ to disable).
4.6.2.8 filtering_db: Name of BLAST database containing filtering elements (i.e.: repeats)
4.6.2.9 window_masker_taxid: Enable windowmasker filtering using a NCBI taxonomy ID. Windowmasker masking files are required; see Search applications’ integration with windowmasker files.
4.6.2.10 window_masker_db: Enable windowmasker filtering using this windowmasker masking file.
4.6.2.11 no_greedy: Use non-greedy dynamic programming extension.
4.6.2.12 min_raw_gapped_score: Minimum raw gapped score to keep an alignment in the preliminary gapped and traceback stages.
4.6.2.13 template_type: Discontiguous megablast template type.
4.6.2.14 template_length: Discontiguous megablast template length.
4.6.3 blastx
4.6.3.1 query_gencode: Genetic code to use to translate the query sequence(s).
4.6.3.2 frame_shift_penalty: Frame shift penalty for use with out-of-frame gapped alignments
4.6.3.3 max_intron_length: Length of the largest intron allowed in a translated nucleotide sequence when linking multiple distinct alignments (a negative value disables linking).
4.6.4 tblastx
4.6.4.1 db_gencode: Genetic code to use to translate database/subjects.
4.6.4.2 max_intron_length: Identical to blastx.
4.6.5 tblastn
4.6.5.1 db_gencode: Identical to tblastx.
4.6.5.2 frame_shift_penalty: Identical to blastx.
4.6.5.3 max_intron_length: Identical to blastx.
4.6.5.4 comp_based_stats: Identical to blastp.
4.6.5.5 use_sw_tback: Identical to blastp.
4.6.5.6 in_pssm: Checkpoint file to initiate PSI-TBLASTN (currently unimplemented).
4.6.6 psiblast
4.6.6.1 comp_based_stats: Identical to blastp with the exception that only composition based statistics mode 1 is valid when aPSSM is the input (either when restarting from a checkpoint file or when performing multiple PSI-BLAST iterations).
4.6.6.2 gap_trigger: Number of bits to trigger gapping.
4.6.6.3 use_sw_tback: Identical to blastp.
4.6.6.4 num_iterations: Number of iterations to perform.
4.6.6.5 out_pssm: Name of the file to store checkpoint file containing a PSSM.
4.6.6.6 out_ascii_pssm: Name of the file to stire ASCII version of PSSM.
4.6.6.7 in_msa: Name of the file containing multiple sequence alignment to restart PSI-BLAST. For input format, please see the Input formats to BLAST section.
4.6.6.8 msa_master_idx: Ordinal number (i.e.: 1-based index) of the sequence in the multiple sequence alignment file to use as master sequence. For the rationale and sample usage of this option, please see its Cookbook entry.
4.6.6.9 ignore_msa_master: Ignore the first sequence (usually the master sequence) in the multiple sequence alignment file when creating the PSSM. For the rationale and sample usage of this option, please see its Cookbook entry.
4.6.6.10 in_pssm: Checkpoint file to re-start PSI-BLAST.
4.6.6.11 pseudocount: Pseudo-count value used when constructing the PSSM.
4.6.6.12 inclusion_ethresh: E-value inclusion threshold for pairwise alignments to be considered to build the PSSM.
4.6.6.13 phi_pattern: Name of the file containing a PHI-BLAST pattern to search.
4.6.7 rpstblastn
4.6.7.1 query_gencode: Identical to blastx.
4.6.8 makeblastdb
This application serves as a replacement for formatdb.
4.6.8.1 in: Input file or BLAST database name to use as source; the data type is automatically detected. Multiple input files/BLAST databases can be provided, each separated by a space in a string with quotation marks. See section 5.15 for specifics that vary between Windows and UNIX/LINUX/Mac OS X.
4.6.8.2 title: Title for the BLAST database to create
4.6.8.3 parse_seqids: Parse the Seq-id(s) in the FASTA input provided. Please note that this option should be provided consistently among the various applications involved in creating BLAST databases. For instance, the filtering applications as well asconvert2blastmask should use this option if makeblastdb uses it also. Please see section 5.13 for details about the format of the Seq-ids.
4.6.8.4 hash_index: Enables the creation of sequence hash values. These hash values can then be used to quickly determine if a given sequence data exists in this BLAST database.
4.6.8.5 mask_data: Comma-separated list of input files containing masking data to apply to the sequences being added to theBLAST database being created. For more information, see Masking in BLAST databases and the examples.
4.6.8.6 out: Name of the BLAST database to create.
4.6.8.7 max_file_sz: Maximum file size for any of the BLAST database files created.
4.6.8.8 logfile: Name of the file to which the program log should be redirected (stdout by default).
4.6.8.9 taxid: Taxonomy ID to assign to all sequences.
4.6.8.10 taxid_map: Name of file which provides a mapping of sequence IDs to NCBI taxonomy IDs. This file should contain one line per sequence ID, and each line should contain a sequence ID followed by a taxonomy ID (an integer) separated by a single space.
4.6.9 blastdb_aliastool
This application replaces part of the functionality offered by formatdb. When formatting a large input FASTA sequence file into aBLAST database, makeblastdb breaks up the resulting database into optimal sized volumes and links the volumes into a large virtual database through an automatically created BLAST database alias file.
We can use BLASTdatabase alias files under different scenarios to manage the collection of BLAST databases and facilitate BLAST searches. For example, we can create an alias file to combine an existing BLAST database with newly generated ones while leaving the original one undisturbed. Also, for an existing BLAST database, we can create a BLAST database alias file based on a GI list so we can search a subset of it, eliminating the need of creating a new database. For examples of how to use this application, please see the cookbook section.
This application supports three modes of operation:
1) Gi file conversion:
Converts a text file containing GIs (one per line) to a more efficient
binary format. This can be provided as an argument to the -gilist option
of the BLAST search command line binaries or to the -gilist option of
this program to create an alias file for a BLAST database (see below).
2) Alias file creation (restricting with GI List):
Creates an alias for a BLAST database and a GI list which restricts this
database. This is useful if one often searches a subset of a database
(e.g., based on organism or a curated list). The alias file makes the
search appear as if one were searching a regular BLAST database rather
than the subset of one.
3) Alias file creation (aggregating BLAST databases):
Creates an alias for multiple BLAST databases. All databases must be of
the same molecule type (no validation is done). The relevant options are
-dblist and -num_volumes.
4.6.9.1 gi_file_in: Text file to convert, should contain one GI per line.
4.6.9.2 gi_file_out: File name of converted GI file
4.6.9.3 title: Title for BLAST database.
4.6.9.4 gilist: Name of the file containing the GIs to restrict the database provided in -db.
4.6.9.5 out: Identical to makeblastdb.
4.6.9.6 logfile: Identical to makeblastdb.
Please note that when using GI lists, the expect values in the BLAST results are based upon the sequences actually searched and not on the underlying database.
4.6.10 blastdbcmd
This application is the successor to fastacmd. The following are its supported options:
4.6.10.1 entry: A comma-delimited search string of sequence identifiers, or the keyword ‘all’ to select all sequences in the database.
4.6.10.2 entry_batch: Input file for batch processing, entries must be provided one per line. If input is provided on standard input, a ‘-‘ should be used to indicate this.
4.6.10.3 pig: PIG (Protein Identity Group) to retrieve.
4.6.10.4 info: Print BLAST database information (overrides all other options).
4.6.10.5 range: Selects the range of a sequence to extract in 1-based offsets (Format: start-stop).
4.6.10.6 strand: Strand of nucleotide sequence to extract.
4.6.10.7 outfmt: Output format string. For a list of available format specifiers, invoke the application with its -help option. Note that for all format specifiers except %f, each line of output will correspond to a single sequence. This should be specified using double quotes if there are spaces in the output format specification (e.g.: -outfmt "%g %t").
4.6.10.8 target_only: The definition line of the sequence should contain target GI only.
4.6.10.9 get_dups: Retrieve duplicate accessions
4.6.10.10 line_length: Line length for output (applicable only with FASTA output format).
4.6.10.11 ctrl_a: Use Ctrl-A as the non-redundant defline separator (applicable only with FASTA output format).
4.6.10.12 mask_sequence_with: Allows the specification of a filtering algorithm ID from the BLAST database to apply to the sequence data. Applicable only with FASTA and sequence data output formats (%f and %s respectively).
4.6.10.13 list: Display the BLAST databases available in the directory provided as an argument to this option.
4.6.10.14 list_outfmt: Allows for the specification of the output format for the -list option; a listing of the possible format types is available via the application’s -help option. Unsupported output specifiers will be ignored. This option’s argument should be specified using double quotes if there are spaces in the output format specification.
4.6.10.15 recursive: Recursively traverse the directory provided to the –list option to find and display available BLAST databases.
4.6.10.16 show_blastdb_search_path: Displays the default BLAST database search paths (separated by colons).
4.6.11 convert2blastmask
This application extracts the lower-case masks from its FASTA input and converts them to a file format suitable for specifyingmasking information to makeblastdb. The following are its supported options:
4.6.11.1 masking_algorithm: The name of the masking algorithm used to create the masks (e.g.: dust, seg, windowmasker, repeat).
4.6.11.2 masking_options: The options used to configure the masking algorithm.
4.6.11.3 in: Name of the input file, by default is standard input.
4.6.11.4 output: Name of the output file, by default is standard output.
4.6.11.5 outfmt: Output file format.
4.6.11.6 parse_seqids: Identical to makeblastdb.
4.6.12 blastdbcheck
This application performs tests on BLAST databases to check their integrity. The following are its supported options:
4.6.12.1 dir: Name of the directory where to look for BLAST databases.
4.6.12.2 recursive: Flag to specify whether to recursively search for BLAST databases in the directory specified above.
4.6.12.3 full: Check every database sequence.
4.6.12.4 stride: Check every Nth database sequence.
4.6.12.5 samples: Check a randomly selected set of N sequences.
4.6.12.6 ends: Check the beginning and ending N sequences in the database.
4.6.12.7 isam: Set to true to perform ISAM file checking on each of the selected sequences.
4.6.13 blast_formatter
This application formats both local and remote BLAST results. An RID is required to format remote BLAST results. The RID may be obtained either from a search submitted to the NCBI BLAST web page or by using the –remote switch with one of the applications mentioned above. The blast_formatter accepts the BLAST archive format for stand-alone formatting. The BLAST archive format can be produced by using “-outfmt 11” argument with the stand-alone applications. For an example of how to use this application, please see its cookbook entry.
4.6.13.1 rid: BLAST RID of the report to be formatted.
4.6.13.2 archive: File produced by BLAST application using –outfmt 11
4.6.14 deltablast
4.6.14.1 domain_inclusion_ethresh: E-value inclusion threshold for alignments between query sequence and a conserved domain to be included in PSSM construction.
4.6.14.2 show_domain_hits: Include in the output matching domains that were used to construct a PSSM.
4.6.14.3 rpsdb: Use other than the standard conserved domain database (cdd_delta) for PSSM construction.
4.7 Configuring BLAST
The BLAST+ search applications can be configured by means of a configuration file named .ncbirc (on Unix-like platforms) or ncbi.ini (on Windows). This is a plain text file which contains sections and key-value pairs to specify configuration parameters. Lines starting with a semi-colon are considered comments. This file will be searched in the following order and locations:
-
1.
-
Current working directory
2.
-
User's HOME directory
3.
-
Directory specified by the NCBI environment variable
The search for this file will stop at the first location where it is found and the configurations settings from that file will be applied. If the configuration file is not found, default values will apply. The following are the possible configuration parameters that impact theBLAST+ applications:
| Configuration Parameter | Specifies | Default value |
| BLASTDB | Path to BLAST databases. | Current working directory |
| DATA_LOADERS | Data loaders to use for automatic sequence identifier resolution. This is a comma separated list of the following keywords: blastdb, genbank, and none. The none keyword disables this feature and takes precedence over any other keywords specified. | blastdb,genbank |
| BLASTDB_PROT_DATA_LOADER | Locally available BLAST database name to search when resolving protein sequences using BLAST databases. Ignored if DATA_LOADERS does not include the blastdb keyword. | nr |
| BLASTDB_NUCL_DATA_LOADER | Locally available BLAST database name to search when resolving nucleotide sequences using BLAST databases. Ignored if DATA_LOADERS does not include the blastdb keyword. | nt |
| GENE_INFO_PATH | Path to gene information files (NCBI only). | Current working directory |
| WINDOW_MASKER_PATH | Path to windowmasker directory hierarchy. | Current working directory |
The following is an example with comments describing the available parameters for configuration:
; Start the section for BLAST configuration [BLAST] ; Specifies the path where BLAST databases are installed BLASTDB=/home/guest/blast/db ; Specifies the data sources to use for automatic resolution ; for sequence identifiers DATA_LOADERS=blastdb ; Specifies the BLAST database to use resolve protein sequences BLASTDB_PROT_DATA_LOADER=custom_protein_database ; Specifies the BLAST database to use resolve protein sequences BLASTDB_NUCL_DATA_LOADER=/home/some_user/my_nucleotide_db ; Windowmasker settings [WINDOW_MASKER] WINDOW_MASKER_PATH=/home/guest/blast/db/windowmasker ; end of file
4.7.1 Memory usage
The BLAST search programs can exhaust all memory on a machine if the input is too large or if there are too many hits to the BLAST database. If this is the case, please see your operating system documentation to limit the memory used by a program (e.g.: ulimit on Unix-like platforms).
4.8 Input formats to BLAST
4.8.1 Multiple sequence alignment
The -in_msa psiblast option provides a way to jump start psiblast from a master-slave multiple sequence alignment computed outside psiblast. The multiple sequence alignment must contain the query sequence as one of its sequences, but it need not be the first sequence. The multiple sequence alignment must be specified in a format that is derived from Clustal, but without some headers and trailers (see example below).
The rules are also described by the following words. Suppose the multiple sequence alignment has N sequences. It may be presented in one or more blocks, where each block presents a range of columns from the multiple sequence alignment. E.g., the first block might have columns 1-60, the second block might have columns 61-95, the third block might have columns 96-128. Each block should have N rows, one row per sequence. The sequences should be in the same order in every block. Blocks are separated by one or more black lines. Within a block there are no blank lines, and each line consists of one sequence identifier followed by some whitespace followed by characters (and gaps) for that sequence in the multiple sequence alignment. In each column, all letters must be in upper case, or all letters must be in lower case.
# Example multiple sequence alignment file align1 ------ 26SPS9_Hs IHAAEEKDWKTAYSYFYEAFEGYdsidspkaitslkymllckimlntpedvqalvsgkla F57B9_Ce LHAADEKDFKTAFSYFYEAFEGYdsvdekvsaltalkymllckvmldlpdevnsllsakl YDL097c_Sc ILHCEDKDYKTAFSYFFESFESYhnltthnsyekacqvlkymllskimlnliddvkniln YMJ5_Ce LYSAEERDYKTSFSYFYEAFEGFasigdkinatsalkymilckimlneteqlagllaake FUS6_ARATH KNYIRTRDYCTTTKHIIHMCMNAilvsiemgqfthvtsyvnkaeqnpetlepmvnaklrc COS41.8_Ci SLDYKLKTYLTIARLYLEDEDPVqaemyinrasllqnetadeqlqihykvcyarvldyrr 644879 KCYSRARDYCTSAKHVINMCLNVikvsvylqnwshvlsyvskaestpeiaeqrgerdsqt YPR108w_Sc IHCLAVRNFKEAAKLLVDSLATFtsieltsyesiatyasvtglftlertdlkskvidspe eif-3p110_Hs SKAMKMGDWKTCHSFIINEKMNGkvw---------------------------------- T23D8.4_Ce SKAMLNGDWKKCQDYIVNDKMNQkvw---------------------------------- YD95_Sp IYLMSIRNFSGAADLLLDCMSTFsstellpyydvvryavisgaisldrvdvktkivdspe KIAA0107_Hs LYCVAIRDFKQAAELFLDTVSTFtsyelmdyktfvtytvyvsmialerpdlrekvikgae F49C12.8_Hs LYRMSVRDFAGAADLFLEAVPTFgsyelmtyenlilytvitttfaldrpdlrtkvircne Int-6_Mm KFQYECGNYSGAAEYLYFFRVLVpatdrnalsslwgklaseilmqnwdaamedltrlket 26SPS9_Hs lryagrqtealkcvaqasknrsladfekaltdy--------------------------- F57B9_Ce alkyngsdldamkaiaaaaqkrslkdfqvafgsf-------------------------- YDL097c_Sc akytketyqsrgidamkavaeaynnrslldfntalkqy---------------------- YMJ5_Ce ivayqkspriiairsmadafrkrslkdfvkalaeh------------------------- FUS6_ARATH asglahlelkkyklaarkfldvnpelgnsyneviapqdiatygglcalasfdrselkqkv COS41.8_Ci kfleaaqrynelsyksaiheteqtkalekalncailapagqqrsrmlatlfkdercqllp 644879 qailtklkcaaglaelaarkykqaakclllasfdhcdfpellspsnvaiygglcalatfd YPR108w_Sc llslisttaalqsissltislyasdyasyfpyllety----------------------- eif-3p110_Hs ------------------------------------------------------------ T23D8.4_Ce ------------------------------------------------------------ YD95_Sp vlavlpqnesmssleacinslylcdysgffrtladve----------------------- KIAA0107_Hs ilevlhslpavrqylfslyecrysvffqslavv--------------------------- F49C12.8_Hs vqeqltggglngtlipvreylesyydchydrffiqlaale-------------------- Int-6_Mm idnnsvssplqslqqrtwlihwslfvffnhpkgrdniidlflyqpqylnaiqtmcphilr 26SPS9_Hs ------------------------------------------------------------ F57B9_Ce ------------------------------------------------------------ YDL097c_Sc ------------------------------------------------------------ YMJ5_Ce ------------------------------------------------------------ FUS6_ARATH idninfrnflelvpdvrelindfyssryascleylasl---------------------- COS41.8_Ci sfgilekmfldriiksdemeefar------------------------------------ 644879 rqelqrnvissssfklflelepqvrdiifkfyeskyasclkmldem-------------- YPR108w_Sc ------------------------------------------------------------ eif-3p110_Hs ------------------------------------------------------------ T23D8.4_Ce ------------------------------------------------------------ YD95_Sp ------------------------------------------------------------ KIAA0107_Hs ------------------------------------------------------------ F49C12.8_Hs ------------------------------------------------------------ Int-6_Mm ylttavitnkdvrkrrqvlkdlvkviqqesytykdpitefveclyvnfdfdgaqkklrec 26SPS9_Hs RAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMI F57B9_Ce PQELQMDPVVRKHFHSLSERMLEKDLCRIIEPYSFVQIEHVAQQIGIDRSKVEKKLSQMI YDL097c_Sc EKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMI YMJ5_Ce KIELVEDKVVAVHSQNLERNMLEKEISRVIEPYSEIELSYIARVIGMTVPPVERAIARMI FUS6_ARATH KSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMADAFKTSVSGLEKELEALI COS41.8_Ci QLMPHQKAITADGSNILHRAVTEHNLLSASKLYNNIRFTELGALLEIPHQMAEKVASQMI 644879 KDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLI YPR108w_Sc ANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFI eif-3p110_Hs DLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMI T23D8.4_Ce NLFHNAETVKGMVVRRIQEESLRTYLLTYSTVYATVSLKKLADLFELSKKDVHSIISKMI YD95_Sp VNHLKCDQFLVAHYRYYVREMRRRAYAQLLESYRALSIDSMAASFGVSVDYIDRDLASFI KIAA0107_Hs EQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFI F49C12.8_Hs SERFKFDRYLSPHFNYYSRGMRHRAYEQFLTPYKTVRIDMMAKDFGVSRAFIDRELHRLI Int-6_Mm ESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLI 26SPS9_Hs LDKKFHGILDQGEGVLIIFDEPP F57B9_Ce LDQKLSGSLDQGEGMLIVFEIAV YDL097c_Sc LDKIFYGVLDQGNGWLYVYETPN YMJ5_Ce LDKKLMGSIDQHGDTVVVYPKAD FUS6_ARATH TDNQIQARIDSHNKILYARHADQ COS41.8_Ci CESRMKGHIDQIDGIVFFERRET 644879 LEGLISARVDSHSKILYARDVDQ YPR108w_Sc PNKQLNCVIDRVNGIVETNRPDN eif-3p110_Hs INEELMASLDQPTQTVVMHRTEP T23D8.4_Ce IQEELSATLDEPTDCLIMHRVEP YD95_Sp PDNKLNCVIDRVNGVVFTNRPDE KIAA0107_Hs AAGRLHCKIDKVNEIVETNRPDS F49C12.8_Hs ATGQLQCRIDAVNGVIEVNHRDS Int-6_Mm RNARLDAKIDSKLGHVVMGNNAV
5. Cookbook
5.1 Query a BLAST database with a GI, but exclude that GI from the results
Extract a GI from the ecoli database: $ blastdbcmd -entry all -db ecoli -dbtype nucl -outfmt %g | head -1 | \ tee exclude_me 1786181 Run the restricted database search, which shows there are no self-hits: $ blastn -db ecoli -negative_gilist exclude_me -show_gis -num_alignments 0 \ -query exclude_me | grep `cat exclude_me` Query= gi|1786181|gb|AE000111.1|AE000111 $
5.2 Create a masked BLAST database
Creating a masked BLAST database is a two step process:
-
a.
-
Generate the masking data using a sequence filtering utility like windowmasker or dustmasker
b.
-
Generate the actual BLAST database using makeblastdb
For both steps, the input file can be a text file containing sequences in FASTA format, or an existing BLAST database created using makeblastdb. We will provide examples for both scenarios.
5.2.1 Collect mask information files
For nucleotide sequence data in FASTA files or BLAST database format, we can generate the mask information files using windowmasker or dustmasker. Windowmasker masks the over-represented sequence data and it can also mask the low complexity sequence data using the built-in dust algorithm (through the -dust option). To mask low-complexity sequences only, we will need to use dustmasker.
For protein sequence data in FASTA files or BLAST database format, we need to use segmasker to generate the mask information file.
The following examples assume that BLAST databases, listed in 5.2.3, are available in the current working directory. Note that you should use the sequence id parsing consistently. In all our examples, we enable this function by including the “-parse_seqids” in the command line arguments.
5.2.1.1 Create masking information using dustmasker
We can generate the masking information with dustmasker using a single command line:
$ dustmasker -in hs_chr -infmt blastdb -parse_seqids \ -outfmt maskinfo_asn1_bin -out hs_chr_dust.asnb
Here we specify the input is a BLAST database named hs_chr (-in hs_chr -infmt blastdb), enable the sequence id parsing (-parse_seqids), request the mask data in binary asn.1 format (-outfmt maskinfo_asn1_bin), and name the output file as hs_chr_dust.asnb (-out hs_chr_dust.asnb).
If the input format is the original FASTA file, hs_chr.fa, we need to change input to -in and -infmt options as follows:
$ dustmasker -in hs_chr.fa -infmt fasta -parse_seqids \ -outfmt maskinfo_asn1_bin -out hs_chr_dust.asnb
5.2.1.2 Create masking information using windowmasker
To generate the masking information using windowmasker from the BLAST database hs_chr, we first need to generate a counts file:
$ windowmasker -in hs_chr -infmt blastdb -mk_counts \ -parse_seqids -out hs_chr_mask.counts
Here we specify the input BLAST database (-in hs_chr -infmt blastdb), request it to generate the counts (-mk_counts) with sequence id parsing (-parse_seqids), and save the output to a file named hs_chr_mask.counts (-out hs_chr_mask.counts).
To use the FASTA file hs_chr.fa to generate the counts, we need to change the input file name and format:
$ windowmasker -in hs_chr.fa -infmt fasta -mk_counts \ -parse_seqids -out hs_chr_mask.counts
With the counts file we can then proceed to create the file containing the masking information as follows:
$ windowmasker -in hs_chr -infmt blastdb -ustat hs_chr_mask.count \ -outfmt maskinfo_asn1_bin -parse_seqids -out hs_chr_mask.asnb
Here we need to use the same input (-in hs_chr -infmt blastdb) and the output of step 1 (-ustat hs_chr_mask.counts). We set the mask file format to binary asn.1 (-outfmt maskinfo_asn1_bin), enable the sequence ids parsing (-parse_seqids), and save themasking data to hs_chr_mask.asnb (-out hs_chr_mask.asnb).
To use the FASTA file hs_chr.fa, we change the input file name and file type:
$ windowmasker -in hs_chr.fa -infmt fasta -ustat hs_chr.counts \ -outfmt maskinfo_asn1_bin -parse_seqids -out hs_chr_mask.asnb
5.2.1.3 Create masking information using segmasker
We can generate the masking information with segmasker using a single command line:
$ segmasker -in refseq_protein -infmt blastdb -parse_seqids \ -outfmt maskinfo_asn1_bin -out refseq_seg.asnb
Here we specify the refseq_protein BLAST database (-in refseq_protein -infmt blastdb), enable sequence ids parsing (-parse_seqids), request the mask data in binary asn.1 format (-outfmt maskinfo_asn1_bin), and name the out file as refseq_seg.asnb (-out refseq_seg.asnb).
If the input format is the FASTA file, we need to change the command line to specify the input format:
$ segmasker -in refseq_protein.fa -infmt fasta -parse_seqids \ -outfmt maskinfo_asn1_bin -out refseq_seg.asnb
5.2.1.4 Extract masking information from FASTA sequences with lowercase masking
We can also extract the masking information from a FASTA sequence file with lowercase masking (generated by various means) using convert2blastmask utility. An example command line follows:
$ convert2blastmask -in hs_chr.mfa -parse_seqids -masking_algorithm repeat \ -masking_options "repeatmasker, default" -outfmt maskinfo_asn1_bin \ -out hs_chr_mfa.asnb
Here the input is hs_chr.mfa (-in hs_chr.mfa), enable parsing of sequence ids, specify the masking algorithm name (-masking_algorithm repeat) and its parameter (-masking_options “repeatmasker, default”), and ask for asn.1 output (-outfmt maskinfo_asn1_bin) to be saved in specified file (-out hs_chr_mfa.asnb).
5.2.2 Create BLAST database with the masking information
Using the masking information data files generated in steps 5.2.1.1, 5.2.1.2, 5.2.1.3, and 5.2.1.4, we can create BLAST database with masking information incorporated.
Note: we should use “-parse_seqids” in a consistent manner – either use it in both steps or not use it at all.
5.2.2.1 Create BLAST database with masking information using an existing BLAST database or FASTA sequence file as input
For example, we can use the following command line to apply the masking information, created in step 5.2.1.2, to the existingBLAST database generated in 5.2.3:
$ makeblastdb -in hs_chr -dbtype nucl -parse_seqids \ -mask_data hs_chr_mask.asnb -out hs_chr -title \ "Human Chromosome, Ref B37.1"
Here, we use the existing BLAST database as input file (-in hs_chr), specify its type (-dbtype nucl), enable parsing of sequence ids (-parse_seqids), provide the masking data from step 5.2.1.2 (-mask_data hs_chr_mask.asnb), and name the output database with the same base name (-out hs_chr) overwriting the existing one.
To use the original FASTA sequence file (hs_chr.fa) as the input, we need to use “-in hs_chr.fa” to instruct makeblastdb to use that FASTA file instead.
We can check the “re-created” database to find out if the masking information was added properly, using blastdbcmd with the following command line:
$ blastdbcmd -db hs_chr -info
This command prints out a summary of the target database:
Database: human chromosomes, Ref B37.1
24 sequences; 3,095,677,412 total bases
Date: Aug 13, 2009 3:02 PM Longest sequence: 249,250,621 bases
Available filtering algorithms applied to database sequences:
Algorithm ID Algorithm name Algorithm options
30 windowmasker
Volumes:
/export/home/tao/blast_test/hs_chr
Extra lines under the “Available filtering algorithms …” describe the masking algorithms available. The “Algorithm ID” field, 30 in our case, is what we need to use if we want to invoke database soft masking during an actual search through the “-db_soft_mask” parameter.
We can apply additional masking data to an existing BLAST database with one type of masking information already added. For example, we can apply the dust masking, generated in step 5.2.1.1, to the database generated in step 5.2.2.1, we can use this command line:
$ makeblastdb -in hs_chr -dbtype nucl -parse_seqids -mask_data \ hs_chr_dust.asnb -out hs_chr -title "Human Chromosome, Ref B37.1"
Here, we use the existing database as input file (-in hs_chr), specify its type (-dbtype nucl), enable parsing of sequence ids (-parse_seqids), provide the masking data from step 5.2.1.1 (-mask_data hs_chr_dust.asnb), naming the database with the same based name (-out hs_chr) overwriting the existing one.
Checking the “re-generated” database with blastdbcmd:
$ blastdbcmd -db hs_chr -info
we can see that both sets of masking information are available:
Database: Human Chromosome, Ref B37.1
24 sequences; 3,095,677,412 total bases
Date: Aug 25, 2009 4:43 PM Longest sequence: 249,250,621 bases
Available filtering algorithms applied to database sequences:
Algorithm ID Algorithm name Algorithm options
11 dust window=64; level=20; linker=1
30 windowmasker
Volumes:
/net/gizmo4/export/home/tao/blast_test/hs_chr
A more straightforward approach to apply multiple sets of masking information in a single makeblastdb run by providing multiple set of masking data files in a comma delimited list:
$ makeblastdb -in hs_chr -dbtype nucl -parse_seqids \ -mask_data hs_chr_dust.asnb, hs_chr_mask.asnb -out hs_chr
5.2.2.2 Create a protein BLAST database with masking information
We can use the masking data file generated in step 5.2.1.3 to create a protein BLAST database:
$ makeblastdb -in refseq_protein -dbtype prot -parse_seqids \ -mask_data refseq_seg.asnb -out refseq_protein -title \ "RefSeq Protein Database"
Using blastdbcmd, we can check the database thus generated:
$ blastdbcmd -db refseq_protein -info
This produces the following summary, which includes the masking information:
Database: RefSeq Protein Database
7,044,477 sequences; 2,469,203,411 total residues
Date: Sep 1, 2009 10:50 AM Longest sequence: 36,805 residues
Available filtering algorithms applied to database sequences:
Algorithm ID Algorithm name Algorithm options
21 seg window=12; locut=2.2; hicut=2.5
Volumes:
/export/home/tao/blast_test/refseq_protein2.00
/export/home/tao/blast_test/refseq_protein2.01
/export/home/tao/blast_test/refseq_protein2.02
5.2.2.3 Create a nucleotide BLAST database using the masking information extracted from lower case masked FASTA file
We use the following command line, which is very similar to that given in 5.2.2.1.
$ makeblastdb -in hs_chr.mfa -dbtype nucl -parse_seqids -mask_data \ hs_chr_mfa.asnb -out hs_chr_mfa -title "Human chromosomes (mfa)"
Here we use the lowercase masked FASTA sequence file as input (-in hs_chr.mfa), specify the database as nucleotide (-dbtype nucl), enable parsing of sequence ids (-parse_seqids), provide the masking data (-mask_data hs_chr_mfa.asnb), and name the resulting database as hs_chr_mfa (-out hs_chr_mfa).
Checking the database thus generated using blastdbcmd, we have:
Database: Human chromosomes (mfa)
24 sequences; 3,095,677,412 total bases
Date: Aug 26, 2009 11:41 AM Longest sequence: 249,250,621 bases
Available filtering algorithms applied to database sequences:
Algorithm ID Algorithm name Algorithm options
40 repeat repeatmasker lowercase
Volumes:
/export/home/tao/hs_chr_mfa
The algorithm name and algorithm options are the values we provided in step 5.2.1.4.
5.2.3 Obtaining Sample data for this cookbook entry
For input nucleotide sequences, we use the BLAST database generated from a FASTA input file hs_chr.fa, containing complete human chromosomes from BUILD37.1, generated by inflating and combining the hs_ref_*.fa.gz files located at:
ftp.ncbi.nlm.nih.gov/genomes/H_sapiens/Assembled_chromosomes/
We use this command line to create the BLAST database from the input nucleotide sequences:
$ makeblastdb -in hs_chr.fa -dbtype nucl -parse_seqids -out hs_chr \ -title "Human chromosomes, Ref B37.1"
For input nucleotide sequences with lowercase masking, we use the FASTA file hs_chr.mfa, containing the complete human chromosomes from BUILD37.1, generated by inflating and combining the hs_ref_*.mfa.gz files located in the same ftp directory.
For input protein sequences, we use the preformatted refseq_protein database from the NCBI blast/db/ ftp directory:
ftp.ncbi.nlm.nih.gov/blast/db/refseq_protein.00.tar.gz
ftp.ncbi.nlm.nih.gov/blast/db/refseq_protein.01.tar.gz
ftp.ncbi.nlm.nih.gov/blast/db/refseq_protein.02.tar.gz
5.3 Search the database with database soft masking information
To enable the database masking during a BLAST search, we need to get the Algorithm ID using the -info parameter of blastdbcmd. For the database generated in step 5.2.2.2, we can use the following command line to activate one of the database soft masking created by windowmasker:
$ blastn -query HTT_gene -task megablast -db hs_chr -db_soft_mask 30 \ -outfmt 7 -out HTT_megablast_mask.out -num_threads 4
Here, we use the blastn program to search a nucleotide query HTT_gene* (-query HTT_gene) with megablast algorithm (-task megablast) against the database created in step 5.2.2.1 (-db hs_chr). We invoke the soft database masking (-db_soft_mask 30), set the result format to tabular output (-outfmt 7), and save the result to a file named HTT_megablast_mask.tab (-out HTT_megablast_mask.tab). We also activated the multi-thread feature of blastn to speed up the search by using 4 CPUs$ (-num_threads 4).
*This is a genomic fragment containing the HTT gene from human, including 5 kb up- and down-stream of the transcribed region. It is represented by NG_009378.
$ The number to use under in your run will depend on the number of CPUs your system has.
In a test run under a 64-bits Linux machine, the above search takes 9.828 seconds real time, while the same run without database soft masking invoked takes 31 minutes 44.651 seconds.
5.4 Extract all human sequences from the nr database
Although one cannot select GIs by taxonomy from a database, a combination of unix command line tools will accomplish this:
$ blastdbcmd -db nr -entry all -outfmt "%g %T" | \
awk ' { if ($2 == 9606) { print $1 } } ' | \
blastdbcmd -db nr -entry_batch - -out human_sequences.txt
The first blastdbcmd invocation produces 2 entries per sequence (GI and taxonomy ID), the awk command selects from the output of that command those sequences which have a taxonomy ID of 9606 (human) and prints its GIs, and finally the second blastdbcmd invocation uses those GIs to print the sequence data for the human sequences in the nr database.
5.5 Custom data extraction and formatting from a BLAST database
The following examples show how to extract selected information from a BLAST database and how to format it:
Extract the accession, sequence length, and masked locations for GI 71022837: $ blastdbcmd -entry 71022837 -db Test/mask-data-db -outfmt "%a %l %m" XP_761648.1 1292 119-139;140-144;147-152;154-160;161-216; Extract the masked FASTA for GI 71022837: $ blastdbcmd -entry 71022837 -db Test/mask-data-db \ -mask_sequence_with 20 -target_only >gi|71022837|ref|XP_761648.1| hypothetical protein UM05501.1 MPPSARHSAHPSHHPHAGGRDLHHAAGGPPPQGGPGMPPGPGNGPMHHPHSSYAQSMPPPPGLPPHAMNGINGPP PSTHGGPPPRMVMADGPGGAGGPPPPPPPHIPRSSSAQSRIMEAaggpagpppagppastspavqklslaNEaaw vsiGsaaetmedydralsayeaalrhnpysvpalsaiagvhrtldnfekavdyfqrvlnivpengdtWGSMGHCY LMMDDLQRAYTAYQQALYHLPNPKEPKLWYGIGILYDRYGSLEHAEEAFASVVRMDPNYEKANEIYFRLGIIYKQ QNKFPASLECFRYILDNPPRPLTEIDIWFQIGHVYEQQKEFNAAKEAYERVLAENPNHAKVLQQLGWLYHLSNAG FNNQERAIQFLTKSLESDPNDAQSWYLLGRAYMAGQNYNKAYEAYQQAVYRDGKNPTFWCSIGVLYYQINQYRDA LDAYSRAIRLNPYISEVWFDLGSLYEACNNQISDAIHAYERAADLDPDNPQIQQRLQLLRNAEAKGGELPEAPVP QDVHPTAYANNNGMAPGPPTQIGGGPGPSYPPPLVGPQLAGNGGGRGDLSDRDLPGPGHLGSSHSPPPFRGPPGT DDRGARGPPHGALAPMVGGPGGPEPLGRGGFSHSRGPSPGPPRMDPYGRRLGSPPRRSPPPPLRSDVHDGHGAPP HVHGQGHGQGHGQGHGQGHGQGHGQSHGHSHGGEFRGPPPLAAAGPGGPPPPLDHYGRPMGGPMSEREREMEWER EREREREREQAARGYPASGRITPKNEPGYARSQHGGSNAPSPAFGRPPVYGRDEGRDYYNNSHPGSGPGGPRGGY ERGPGAPHAPAPGMRHDERGPPPAPFEHERGPPPPHQAGDLRYDSYSDGRDGPFRGPPPGLGRPTPDWERTRAGE YGPPSLHDGAEGRNAGGSASKSRRGPKAKDELEAAPAPPSPVPSSAGKKGKTTSSRAGSPWSAKGGVAAPGKNGK ASTPFGTGVGAPVAAAGVGGGVGSKKGAAISLRPQEDQPDSRPGSPQSRRDASPASSDGSNEPLAARAPSSRMVD EDYDEGAADALMGLAGAASASSASVATAAPAPVSPVATSDRASSAEKRAESSLGKRPYAEEERAVDEPEDSYKRA KSGSAAEIEADATSGGRLNGVSVSAKPEATAAEGTEQPKETRTETPPLAVAQATSPEAINGKAESESAVQPMDVD GREPSKAPSESATAMKDSPSTANPVVAAKASEPSPTAAPPATSMATSEAQPAKADSCEKNNNDEDEREEEEGQIH EDPIDAPAKRADEDGAK
5.6 Display BLAST search results with custom output format
The –outfmt option permits formatting arbitrary fields from the BLAST tabular format. Use the –help option on the command-line application (e.g., blastn) to see the supported fields. The max_target_seqs option should be used with any tabular output to control the number of matches reported.
5.6.1 Example of custom output format
The following example shows how to display the results of a BLAST search using a custom output format. The tabular output format with comments is used, but only the query accession, subject accession, evalue, query start, query stop, subject start, and subject stop are requested. For brevity, only the first 10 lines of output are shown:
$ echo 1786181 | ./blastn -db ecoli -outfmt "7 qacc sacc evalue qstart qend sstart send" # BLASTN 2.2.18+ # Query: gi|1786181|gb|AE000111.1|AE000111 # Database: ecoli # Fields: query acc., subject acc., evalue, q. start, q. end, s. start, s. end # 85 hits found AE000111 AE000111 0.0 1 10596 1 10596 AE000111 AE000174 8e-30 5565 5671 6928 6821 AE000111 AE000394 1e-27 5587 5671 135 219 AE000111 AE000425 6e-26 5587 5671 8552 8468 AE000111 AE000171 3e-24 5587 5671 2214 2130 $
5.6.2 Trace-back operations (BTOP)
The “Blast trace-back operations” (BTOP) string describes the alignment produced by BLAST. This string is similar to the CIGAR string produced in SAM format, but there are important differences. BTOP is a more flexible format that lists not only the aligned region but also matches and mismatches. BTOP operations consist of 1.) a number with a count of matching letters, 2.) two letters showing a mismatch (e.g., “AG” means A was replaced by G), or 3.) a dash (“-“) and a letter showing a gap. The box below shows a blastn run first with BTOP output and then the same run with the BLAST report showing the alignments.
$ blastn -query test_q.fa -subject test_s.fa -dust no -outfmt "6 qseqid sseqid btop" -parse_deflines query1 q_multi 7AG39 query1 q_multi 7A-39 query1 q_multi 6-G-A41 $ blastn -query test_q.fa -subject test_s.fa -dust no -parse_deflines BLASTN 2.2.24+ Query= query1 Length=47 Subject= Length=142 Score = 82.4 bits (44), Expect = 9e-22 Identities = 46/47 (97%), Gaps = 0/47 (0%) Strand=Plus/Plus Query 1 ACGTCCGAGACGCGAGCAGCGAGCAGCAGAGCGACGAGCAGCGACGA 47 ||||||| ||||||||||||||||||||||||||||||||||||||| Sbjct 47 ACGTCCGGGACGCGAGCAGCGAGCAGCAGAGCGACGAGCAGCGACGA 93 Score = 80.5 bits (43), Expect = 3e-21 Identities = 46/47 (97%), Gaps = 1/47 (2%) Strand=Plus/Plus Query 1 ACGTCCGAGACGCGAGCAGCGAGCAGCAGAGCGACGAGCAGCGACGA 47 ||||||| ||||||||||||||||||||||||||||||||||||||| Sbjct 1 ACGTCCG-GACGCGAGCAGCGAGCAGCAGAGCGACGAGCAGCGACGA 46 Score = 78.7 bits (42), Expect = 1e-20 Identities = 47/49 (95%), Gaps = 2/49 (4%) Strand=Plus/Plus Query 1 ACGTCC--GAGACGCGAGCAGCGAGCAGCAGAGCGACGAGCAGCGACGA 47 |||||| ||||||||||||||||||||||||||||||||||||||||| Sbjct 94 ACGTCCGAGAGACGCGAGCAGCGAGCAGCAGAGCGACGAGCAGCGACGA 142
5.7 Use blastdb_aliastool to manage the BLAST databases
Often we need to search multiple databases together or wish to search a specific subset of sequences within an existing database. At the BLAST search level, we can provide multiple database names to the “-db” parameter, or to provide a GI file specifying the desired subset to the “-gilist” parameter. However for these types of searches, a more convenient way to conduct them is by creating virtual BLAST databases for these. Note: When combining BLAST databases, all the databases must be of the same molecule type. The following examples assume that the two databases as well as the GI file are in the current working directory.
5.7.1 Aggregate existing BLAST databases
To combine the two nematode nucleotide databases, named “nematode_mrna” and “nematode_genomic", we use the following command line:
$ blastdb_aliastool -dblist "nematode_mrna nematode_genomic" -dbtype nucl \ -out nematode_all -title "Nematode RefSeq mRNA + Genomic"
5.7.2 Create a subset of a BLAST database
The nematode_mrna database contains RefSeq mRNAs for several species of round worms. The best subset is from C. elegance. In most cases, we want to search this subset instead of the complete collection. Since the database entries are from NCBI nucleotide databases and the database is formatted with ”-parse_seqids”, we can use the “-gilist c_elegance_mrna.gi” parameter/value pair to limit the search to the subset of interest, alternatively, we can create a subset of the nematode_mrna database as follows:
$ blastdb_aliastool -db nematode_mrna -gilist c_elegance_mrna.gi -dbtype \ nucl -out c_elegance_mrna -title "C. elegans refseq mRNA entries"
Note: one can also specify multiple databases using the -db parameter of blastdb_aliastool.
5.8 Reformat BLAST reports with blast_formatter
It may be helpful to view the same BLAST results in different formats. A user may first parse the tabular format looking for matches meeting a certain criteria, then go back and examine the relevant alignments in the full BLAST report. He may also first look at pair-wise alignments, then decide to use a query-anchored view. Viewing a BLAST report in different formats has been possible on the NCBI BLAST web site since 2000, but has not been possible with stand-alone BLAST runs. The blast_formatter allows this, if the original search produced blast archive format using the –outfmt 11 switch. The query sequence, the BLAST options, the maskinginformation, the name of the database, and the alignment are written out as ASN.1 (a structured format similar to XML). The –max_target_seqs option should be used to control the number of matches recorded in the alignment. The blast_formatter reads this information and formats a report. The BLAST database used for the original search must be available, or the sequences need to be fetched from the NCBI, assuming the database contains sequences in the public dataset. The box below illustrates the procedure. A blastn run first produces the BLAST archive format, and the blast_fomatter then reads the file and produces tabular output.
Blast_formatter will format stand-alone searches performed with an earlier version of a database if both the search and formatting databases are prepared so that fetching by sequence ID is possible. To enable fetching by sequence ID use the –parse_seqids flag when running makeblastdb, or (if available) download preformatted BLAST databases from ftp://ftp.ncbi.nlm.nih.gov/blast/db/ using update_blastdb.pl (provided as part of the BLAST+ package). Currently the blast archive format and blast_formatter do not work with database free searches (i.e., -subject rather than –db was used for the original search).
$ echo 1786181 | blastn -db ecoli -outfmt 11 -out out.1786181.asn $ blast_formatter -archive out.1786181.asn -outfmt "7 qacc sacc evalue qstart qend sstart send" # BLASTN 2.2.24+ # Query: gi|1786181|gb|AE000111.1|AE000111 Escherichia coli K-12 MG1655 section 1 of 400 # Database: ecoli # Fields: query acc., subject acc., evalue, q. start, q. end, s. start, s. end # 85 hits found AE000111 AE000111 0.0 1 10596 1 10596 AE000111 AE000174 8e-30 5565 5671 6928 6821 AE000111 AE000394 1e-27 5587 5671 135 219 AE000111 AE000425 6e-26 5587 5671 8552 8468 AE000111 AE000171 3e-24 5587 5671 2214 2130 AE000111 AE000171 1e-23 5587 5670 10559 10642 AE000111 AE000376 1e-22 5587 5675 129 42 AE000111 AE000268 1e-22 5587 5671 6174 6090 AE000111 AE000112 1e-22 10539 10596 1 58 AE000111 AE000447 5e-22 5587 5670 681 598 AE000111 AE000344 6e-21 5587 5671 4112 4196 AE000111 AE000490 2e-20 5584 5671 4921 4835 AE000111 AE000280 2e-20 5587 5670 12930 12847
5.9 Extract lowercase masked FASTA from a BLAST database with masking information
If a BLAST database contains masking information, this can be extracted using the blastdbcmd options –db_mask and –mask_sequence as follows:
$ blastdbcmd -info -db mask-data-db
Database: Mask data test
10 sequences; 12,609 total residues
Date: Feb 17, 2009 5:10 PM Longest sequence: 1,694 residues
Available filtering algorithms applied to database sequences:
Algorithm ID Algorithm name Algorithm options
20 seg default options used
40 repeat -species Desmodus_rotundus
Volumes:
mask-data-db
$ blastdbcmd -db mask-data-db -mask_sequence_with 20 -entry 71022837
>gi|71022837|ref|XP_761648.1| hypothetical protein UM05501.1 [Ustilago maydis 521]
MPPSARHSAHPSHHPHAGGRDLHHAAGGPPPQGGPGMPPGPGNGPMHHPHSSYAQSMPPPPGLPPHAMNGINGPPPSTHG
GPPPRMVMADGPGGAGGPPPPPPPHIPRSSSAQSRIMEAaggpagpppagppastspavQklslANEaawvsIGsaaetm
EdydralsayeaalrhnpysvpalsaiagvhrtldnfekavdyfqrvlnivpengdTWGSMGHCYLMMDDLQRAYTAYQQ
ALYHLPNPKEPKLWYGIGILYDRYGSLEHAEEAFASVVRMDPNYEKANEIYFRLGIIYKQQNKFPASLECFRYILDNPPR
PLTEIDIWFQIGHVYEQQKEFNAAKEAYERVLAENPNHAKVLQQLGWLYHLSNAGFNNQERAIQFLTKSLESDPNDAQSW
YLLGRAYMAGQNYNKAYEAYQQAVYRDGKNPTFWCSIGVLYYQINQYRDALDAYSRAIRLNPYISEVWFDLGSLYEACNN
QISDAIHAYERAADLDPDNPQIQQRLQLLRNAEAKGGELPEAPVPQDVHPTAYANNNGMAPGPPTQIGGGPGPSYPPPLV
GPQLAGNGGGRGDLSDRDLPGPGHLGSSHSPPPFRGPPGTDDRGARGPPHGALAPMVGGPGGPEPLGRGGFSHSRGPSPG
PPRMDPYGRRLGSPPRRSPPPPLRSDVHDGHGAPPHVHGQGHGQGHGQGHGQGHGQGHGQSHGHSHGGEFRGPPPLAAAG
PGGPPPPLDHYGRPMGGPMSEREREMEWEREREREREREQAARGYPASGRITPKNEPGYARSQHGGSNAPSPAFGRPPVY
GRDEGRDYYNNSHPGSGPGGPRGGYERGPGAPHAPAPGMRHDERGPPPAPFEHERGPPPPHQAGDLRYDSYSDGRDGPFR
GPPPGLGRPTPDWERTRAGEYGPPSLHDGAEGRNAGGSASKSRRGPKAKDELEAAPAPPSPVPSSAGKKGKTTSSRAGSP
WSAKGGVAAPGKNGKASTPFGTGVGAPVAAAGVGGGVGSKKGAAISLRPQEDQPDSRPGSPQSRRDASPASSDGSNEPLA
ARAPSSRMVDEDYDEGAADALMGLAGAASASSASVATAAPAPVSPVATSDRASSAEKRAESSLGKRPYAEEERAVDEPED
SYKRAKSGSAAEIEADATSGGRLNGVSVSAKPEATAAEGTEQPKETRTETPPLAVAQATSPEAINGKAESESAVQPMDVD
GREPSKAPSESATAMKDSPSTANPVVAAKASEPSPTAAPPATSMATSEAQPAKADSCEKNNNDEDEREEEEGQIHEDPID
APAKRADEDGAK
$
5.10 Display the locations where BLAST will search for BLAST databases
This is accomplished by using the -show_blastdb_search_path option in blastdbcmd:
$ blastdbcmd -show_blastdb_search_path :/net/nabl000/vol/blast/db/blast1:/net/nabl000/vol/blast/db/blast2: $
5.11 Display the available BLAST databases at a given directory:
This is accomplished by using the -list option in blastdbcmd:
$ blastdbcmd -list repeat -recursive repeat/repeat_3055 Nucleotide repeat/repeat_31032 Nucleotide repeat/repeat_35128 Nucleotide repeat/repeat_3702 Nucleotide repeat/repeat_40674 Nucleotide repeat/repeat_4530 Nucleotide repeat/repeat_4751 Nucleotide repeat/repeat_6238 Nucleotide repeat/repeat_6239 Nucleotide repeat/repeat_7165 Nucleotide repeat/repeat_7227 Nucleotide repeat/repeat_7719 Nucleotide repeat/repeat_7955 Nucleotide repeat/repeat_9606 Nucleotide repeat/repeat_9989 Nucleotide $
The first column of the default output is the file name of the BLAST database (usually provided as the –db argument to other BLAST+ applications), the second column represents the molecule type of the BLAST database. This output is configurable via the list_outfmt command line option.
5.12 Use Windowmasker to filter your BLAST search
The following example shows the steps required to use BLAST and Windowmasker. In the following example, we are starting with aFASTA file containing the sequences from the human build 36.3 (hs.36.3.fsa). The output is removed for brevity. Please note that steps 1-4 need to be performed only once to generate the windowmasker unit counts files and that similarly, step 5 needs to be done only once to configure BLAST+.
1. Create the unit counts data (WinMask Stage 1) $ windowmasker -in hs.36.3.fsa -infmt fasta -mk_counts true \ -sformat obinary -out wmasker.obinary 2. Create a masked version of the original FASTA file using dust and the previously created unit counts data file (WinMask Stage 2) $ windowmasker -in hs.36.3.fsa -out hs.36.3.masked.fsa -dust true \ -ustat wmasker.obinary -outfmt fasta 3. Create a masked BLAST database $ makeblastdb -out human.36.3.masked -in hs.36.3.masked.fsa \ -dbtype nucl 4. Make masked index $ makembindex -input hs.36.3.masked.fsa -iformat fasta -volsize 1024 \ -output human.36.3.masked 5. Install and configure BLAST databases $ mkdir -p /usr/local/ncbi/blast/db /usr/local/ncbi/blast/windowmasker/9606 $ cp hs.36.3.masked.* /usr/local/ncbi/blast/db $ cp wmasker.obinary /usr/local/ncbi/blast/windowmasker/9606 $ echo [BLAST] > .ncbirc $ echo BLASTDB=/usr/local/ncbi/blast/db >> .ncbirc $ echo [WINDOW_MASKER] >> .ncbirc $ echo WINDOW_MASKER_PATH=/usr/local/ncbi/blast/windowmasker >> .ncbirc 6. Run BLAST search using Windowmasker for sequence filtering $ blastn -query input -db database -window_masker_taxid 9606 -out results.txt
5.13 Building a BLAST database with local sequences
The makeblastdb application produces BLAST databases from FASTA files. In the simplest case the FASTA definition lines are not parsed by makeblastdb and may be completely unstructured. The text in the definition line will be stored in the BLAST database and displayed in the BLAST report, but it will not be possible to fetch individual sequences using blastdbcmd or to limit the search with the –seqidlist option. Use the –parse_seqids flag when invoking makeblastdb to enable retrieval of sequences based upon sequence identifiers. In this case, each sequence must have a unique identifier, and that identifier must have a specific format. The identifier should begin right after the “>” sign on the definition line, contain no spaces, and follow the formats described inhttp://www.ncbi.nlm.nih.gov/books/NBK7183/?rendertype=table&id=ch_demo.T5 User supplied sequences should make use of the local or general identifiers described in the above table. A FASTA file with general IDs would look like:
$ cat mydb.fsa >gnl|MYDB|1 this is sequence 1 GAATTCCCGCTACAGGGGGGGCCTGAGGCACTGCAGAAAGTGGGCCTGAGCCTCGAGGATGACGGTGCTGCAGGAACCCG TCCAGGCTGCTATATGGCAAGCACTAAACCACTATGCTTACCGAGATGCGGTTTTCCTCGCAGAACGCCTTTATGCAGAA GTACACTCAGAAGAAGCCTTGTTTTTACTGGCAACCTGTTATTACCGCTCAGGAAAGGCATATAAAGCATATAGACTCTT GAAAGGACACAGTTGTACTACACCGCAATGCAAATACCTGCTTGCAAAATGTTGTGTTGATCTCAGCAAGCTTGCAGAAG GGGAACAAATCTTATCTGGTGGAGTGTTTAATAAGCAGAAAAGCCATGATGATATTGTTACTGAGTTTGGTGATTCAGCT TGCTTTACTCTTTCATTGTTGGGACATGTATATTGCAAGACAGATCGGCTTGCCAAAGGATCAGAATGTTACCAAAAGAG CCTTAGTTTAAATCCTTTCCTCTGGTCTCCCTTTGAATCATTATGTGAAATAGGTGAAAAGCCAGATCCTGACCAAACAT TTAAATTCACATCTTTACAGAACTTTAGCAACTGTCTGCCCAACTCTTGCACAACACAAGTACCTAATCATAGTTTATCT CACAGACAGCCTGAGACAGTTCTTACGGAAACACCCCAGGACACAATTGAATTAAACAGATTGAATTTAGAATCTTCCAA >gnl|MYDB|2 this is sequence 2 GAATTCCCGCTACAGGGGGGGCCTGAGGCACTGCAGAAAGTGGGCCTGAGCCTCGAGGATGACGGTGCTGCAGGAACCCG TCCAGGCTGCTATATGGCAAGCACTAAACCACTATGCTTACCGAGATGCGGTTTTCCTCGCAGAACGCCTTTATGCAGAA GTACACTCAGAAGAAGCCTTGTTTTTACTGGCAACCTGTTATTACCGCTCAGGAAAGGCATATAAAGCATATAGACTCTT GAAAGGACACAGTTGTACTACACCGCAATGCAAATACCTGCTTGCAAAATGTTGTGTTGATCTCAGCAAGCTTGCAGAAG GGGAACAAATCTTATCTGGTGGAGTGTTTAATAAGCAGAAAAGCCATGATGATATTGTTACTGAGTTTGGTGATTCAGCT TGCTTTACTCTTTCATTGTTGGGACATGTATATTGCAAGACAGATCGGCTTGCCAAAGGATCAGAATGTTACCAAAAGAG CCTTAGTTTAAATCCTTTCCTCTGGTCTCCCTTTGAATCATTATGTGAAATAGGTGAAAAGCCAGATCCTGACCAAACAT TTAAATTCACATCTTTACAGAACTTTAGCAACTGTCTGCCCAACTCTTGCACAACACAAGTACCTAATCATAGTTTATCT CACAGACAGCCTGAGACAGTTCTTACGGAAACACCCCAGGACACAATTGAATTAAACAGATTGAATTTAGAATCTTCCAA >gnl|MYDB|3 this is sequence 3 GAATTCCCGCTACAGGGGGGGCCTGAGGCACTGCAGAAAGTGGGCCTGAGCCTCGAGGATGACGGTGCTGCAGGAACCCG TCCAGGCTGCTATATGGCAAGCACTAAACCACTATGCTTACCGAGATGCGGTTTTCCTCGCAGAACGCCTTTATGCAGAA GTACACTCAGAAGAAGCCTTGTTTTTACTGGCAACCTGTTATTACCGCTCAGGAAAGGCATATAAAGCATATAGACTCTT GAAAGGACACAGTTGTACTACACCGCAATGCAAATACCTGCTTGCAAAATGTTGTGTTGATCTCAGCAAGCTTGCAGAAG GGGAACAAATCTTATCTGGTGGAGTGTTTAATAAGCAGAAAAGCCATGATGATATTGTTACTGAGTTTGGTGATTCAGCT TGCTTTACTCTTTCATTGTTGGGACATGTATATTGCAAGACAGATCGGCTTGCCAAAGGATCAGAATGTTACCAAAAGAG CCTTAGTTTAAATCCTTTCCTCTGGTCTCCCTTTGAATCATTATGTGAAATAGGTGAAAAGCCAGATCCTGACCAAACAT TTAAATTCACATCTTTACAGAACTTTAGCAACTGTCTGCCCAACTCTTGCACAACACAAGTACCTAATCATAGTTTATCT$
Makeblastdb can be invoked for this file as below.
$ makeblastdb -in mydb.fsa -parse_seqids -dbtype nucl Building a new DB, current time: 01/28/2011 13:39:37 New DB name: mydb.fsa New DB title: mydb.fsa Sequence type: Nucleotide Keep Linkouts: T Keep MBits: T Maximum file size: 1073741824B Adding sequences from FASTA; added 3 sequences in 0.00206995 seconds. $
The FASTA file has three entries. All entries are part of the “MYDB” database, with the entries numbers 1, 2, and 3. Makeblastdb will store this information properly and produce an index, so that the sequences can be retrieved by these identifiers. Makeblastdb stores the title portion of the definition line (e.g., “this is sequence 1”), but will not parse it. If the first token after the “>” does not contain a bar (“|”) it will be parsed as a local ID. Use the full identifier string (e.g., “gnl|MYDB|2”) to retrieve sequences with a general ID
The NCBI makes databases that are searchable on the NCBI web site (such as nr, refseq_rna, and swissprot) available on its FTP site. It is better to download the preformatted databases rather than starting with FASTA. The databases on the FTP site contain taxonomic information for each sequence, include the identifier indices for lookups, and can be up to four times smaller than the FASTA. The original FASTA can be generated from the BLAST database using blastdbcmd.
5.14 Limiting a Search with a List of Identifiers
BLAST can now limit a database search by a list of text identifiers, which are specified as whitespace-separated strings in a text formatted file. These identifiers, referencing the sequences to include in BLAST search, should not contain any whitespace and must be resolvable through the BLAST database ID lookup. In some cases this means that the entire bar-delimited format (specified inhttp://www.ncbi.nlm.nih.gov/books/NBK7183/?rendertype=table&id=ch_demo.T5) must be used. In other cases it is enough to simply specify an accession. For the “general” example from section 5.13 a valid ID would be “gnl|MYDB|2”. On the other hand, if the identifier is “gi|15674171|ref|NP_268346.1”, one of the following string is sufficient:
“gi|15674171|ref|NP_268346.1”, “15674171”, “ref|NP_268346”, “NP_268346”, “NP_268346.1”, etc.
When the search is limited by a list of IDs the statistics of the BLAST database are re-calculated to reflect the actual number of sequences and residuals/base included in search.
BLAST has been able to limit a search by a list of GI’s for a number of years. It is important to note that the performance of a binary list of GI’s will always be superior to a list of text IDs. The binary list of GI’s can be formatted to require minimal conversion at run time. If all the sequences in the database have been assigned a GI, a binary list of GI’s should be used rather than a list of accessions.
5.15 Multiple databases vs. spaces in filenames and paths
BLAST has been able to search multiple databases since 1997. The databases can be listed after the “-db” argument or in an alias file (see section on blastdb_aliastool), separated by spaces. Many operating systems now allow spaces in filenames and directory paths, so some care is required. Basically, one should always have two sets of quotes for any path containing a space. Blastdbcmd is used as an example below, but the same rules apply to makeblastdb as well as the search programs like blastn or blastp.
To access a BLAST database containing spaces under Microsoft Windows it is necessary to use two sets of double-quotes, escaping the innermost quotes with a backslash. For example, Users\joeuser\My Documents\Downloads would be accessed by:
blastdbcmd -db "\"Users\joeuser\My Documents\Downloads\mydb\"" -info
The first backslash escapes the beginning inner quote, and the backslash following “mydb” escapes the ending inner quote.
A second database can be added to this command by including it within the outer pair of quotes:
blastdbcmd -db "\"Users\joeuser\My Documents\Downloads\mydb\" myotherdb" -info
If the second database had contained a space, it would have been necessary to surround it by quotes escaped by a backslash.
Under UNIX systems (including LINUX and Mac OS X) it is preferable to use a single quote (‘) in place of the escaped double quote:
blastdbcmd -db ‘ "path with spaces/mydb" ’ -info
Multiple databases can also be listed within the single quotes, similar to the procedure described for Microsoft Windows.
5.16 Specifying a sequence as the multiple sequence alignment master in psiblast
The -in_msa psiblast option, unlike blastpgp, does not support the specification of a master sequence via the -query option, so if one wants to specify a sequence (other than the first one) in the multiple sequence alignment file to be the master sequence, this has to be specified via the -msa_master_idx option. For instance, in the example below, the third sequence in the multiple sequence alignment would be used as the master sequence:
psiblast -in_msa align1 -db pataa -msa_master_idx 3
5.17 Ignoring the consensus sequence in the multiple sequence alignment in psiblast
Often a consensus sequence is added to a multiple sequence alignment to be used as the master sequence in a PSI-BLAST search. The consensus sequence provides a good option to display the query-subject alignment in the output and to define which MSA columns are to be converted to PSSM. At the same time adding the consensus sequence changes the statistical properties of the original alignment. To avoid this, the -ignore_msa_master option can be used:
psiblast -in_msa align1 -db pataa -ignore_msa_master
In this case the master sequence is displayed in the output but ignored when the PSSM scores are calculated.
5.18 Performing a DELTA-BLAST search
DELTA-BLAST searches a protein sequence database using a PSSM constructed from conserved domains matching a query. It first searches the NCBI CDD database to construct the PSSM.
5.18.1 Download the cdd_delta database
Obtain this database from ftp://ftp.ncbi.nlm.nih.gov/blast/db using the update_blastdb.pl tool (provided as part of the BLAST+ package). Note that the cdd_delta database must be downloaded and installed to the standard BLAST database directory (seeConfiguring BLAST) or in the current working directory.
5万+

被折叠的 条评论
为什么被折叠?



